PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10009780
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 289aa    MW: 32527.6 Da    PI: 5.3171
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10009780genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding414.3e-131055146
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                     +g+W +eEd+ l++ v+++G++ W++I ++  + Rt+k+c++rw +
      Lus10009780 10 KGPWKAEEDQVLINHVHKYGPREWSSIRSKGLLQRTGKSCRLRWVN 55
                     79*************************8887799**********87 PP

2Myb_DNA-binding40.65.8e-1366105344
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44 
                      ++++eE+ + +++ ++lG++ W++Ia ++  gRt++++k++w
      Lus10009780  66 KFSEEEQRIVIELQARLGNK-WAKIATYLA-GRTDNDVKNFW 105
                      79******************.*********.*********** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.2E-21358IPR009057Homeodomain-like
PROSITE profilePS5129420.798561IPR017930Myb domain
SuperFamilySSF466894.67E-278105IPR009057Homeodomain-like
SMARTSM007176.7E-10959IPR001005SANT/Myb domain
PfamPF002491.3E-111055IPR001005SANT/Myb domain
CDDcd001678.05E-101257No hitNo description
Gene3DG3DSA:1.10.10.605.5E-1759111IPR009057Homeodomain-like
PROSITE profilePS5129418.22162113IPR017930Myb domain
SMARTSM007176.0E-1263111IPR001005SANT/Myb domain
CDDcd001672.60E-966105No hitNo description
PfamPF002498.7E-1266105IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048235Biological Processpollen sperm cell differentiation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 289 aa     Download sequence    Send to blast
MEVKNEEVRK GPWKAEEDQV LINHVHKYGP REWSSIRSKG LLQRTGKSCR LRWVNKLRPN  60
LKNGCKFSEE EQRIVIELQA RLGNKWAKIA TYLAGRTDND VKNFWSSRQK RLARLNNNNS  120
CNNSSASNSS KTTKKARTKM SSSTMEEEEA EEEKEEEGPS SSSSKKVQLL CSSNTEEPMK  180
TVPLSVPIVK PELVPVESEP VNPFPQPQPP ELISFSPESQ ELLARLEDPF FFNVFGIPQL  240
GDIPELSLGP PLSDHPLPSC MTGGIDDDDD FPADLFDQID RLPSPSHW*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-30211119126MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001306858.11e-98myb-related protein MYBAS2
TrEMBLA0A0E3NAD02e-98A0A0E3NAD0_JATCU; MYB125
STRINGPOPTR_0002s14180.14e-89(Populus trichocarpa)
STRINGPOPTR_0014s05420.13e-89(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF36933164
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60460.14e-69MYB family protein